PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G239500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 443aa    MW: 49635 Da    PI: 7.3521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G239500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Aqcoe2G239500.1.p 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding43.95.3e-1467110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg ++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Aqcoe2G239500.1.p  67 RGTFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                        899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466894.12E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.3E-151461IPR001005SANT/Myb domain
CDDcd001673.27E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.7E-2565116IPR009057Homeodomain-like
SMARTSM007172.3E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129419.97666116IPR017930Myb domain
PfamPF002496.2E-1367110IPR001005SANT/Myb domain
CDDcd001672.51E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CIKKKLRQRG  120
IDPNTHKPLS EVENCEETTP STTTNNTTSS QRVSGESNEL NLLKGENLKA GVVVTEPKSP  180
LVASDWFSIE GYSNTRMNNN SNNNSTTVTP TKDFFLDRFI NSQRSSTPTS CKPSESMEYY  240
PLQQLNAVSQ NPALWFNQNC RPYEMNPEFN CNSISSLLPS ISTSTLTTSL GHKPAISLPS  300
NNAPPSPFNV GGVQYWEAGT SSNSSRSNSG SSSSIELQSN TSMFENSVYS WGLTDCNATG  360
KEARMYSIEG EPDDIKWPDY LPTSYLNQTP QSICNEIKSE AQFTIDGSNN STWHENQQQQ  420
QLQSPDIYAK DFQRYAAAFG QI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4269491e-132JN426949.1 Epimedium sagittatum R2R3-MYB transcription factor MYB2 (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010240823.11e-174PREDICTED: transcription factor MYB29
TrEMBLH9XUF20.0H9XUF2_9MAGN; R2R3-MYB transcription factor MYB2
STRINGVIT_14s0060g00240.t011e-165(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.39e-89myb domain protein 55